SCOP 1.57: Domain d1bpm_1: 1bpm 1-159

Lineage for d1bpm_1 (1bpm 1-159)

1. Root: SCOP 1.57

2. Class c: Alpha and beta proteins (a/b) [51349] (107 folds)

3. Fold c.50: Leucine aminopeptidase, N-terminal domain [52948] (1 superfamily)

4. Superfamily c.50.1: Leucine aminopeptidase, N-terminal domain [52949] (1 family)

5. Family c.50.1.1: Leucine aminopeptidase, N-terminal domain [52950] (1 protein)

6. Protein Leucine aminopeptidase, N-terminal domain [52951] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [52952] (7 PDB entries)

8. Domain d1bpm_1: 1bpm 1-159 [33172]
   Other proteins in same PDB: d1bpm_2

Details for d1bpm_1

PDB Entry: 1bpm, 2.9 Å

PDB Description: differentiation and identification of the two catalytic metal binding sites in bovine lens leucine aminopeptidase by x-ray crystallography

SCOP Domain Sequences for d1bpm_1:

Sequence, based on SEQRES records:

>d1bpm_1 c.50.1.1 (1-159) Leucine aminopeptidase, N-terminal domain {Cow (Bos taurus)}
tkglvlgiyskekeedepqftsagenfnklvsgklreilnisgpplkagktrtfyglhed
fpsvvvvglgkktagideqenwhegkeniraavaagcrqiqdleipsvevdpcgdaqaaa
egavlglyeyddlkqkrkvvvsaklhgsedqeawqrgvl

Sequence, based on observed residues (ATOM records):

>d1bpm_1 c.50.1.1 (1-159) Leucine aminopeptidase, N-terminal domain {Cow (Bos taurus)}
tkglvlgiyskedepqftsagenfnklvsgklreilnisgpplkagktrtfyglhedfps
vvvvglgkktagideqenwhegkeniraavaagcrqiqdleipsvevdpcgdaqaaaega
vlglyeyddlkqkrkvvvsaklhgsedqeawqrgvl

Timeline for d1bpm_1:

• d1bpm_1 first appeared (with stable ids) in SCOP 1.55
  
• d1bpm_1 appears in SCOP 1.59
  
• d1bpm_1 appears in the current release, SCOPe 2.08, called d1bpma2