SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5lkyb_ (5lky B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2085156Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2086456Family c.1.10.0: automated matches [191319] (1 protein)
    not a true family
  6. 2086457Protein automated matches [190115] (73 species)
    not a true protein
  7. 2086896Species Staphylococcus aureus [TaxId:93061] [193178] (7 PDB entries)
  8. 2288414Domain d5lkyb_: 5lky B: [331715]
    automated match to d4ahob_
    complexed with peg

Details for d5lkyb_

PDB Entry: 5lky (more details), 1.7 Å

PDB Description: x-ray crystal structure of n-acetylneuraminic acid lyase in complex with pyruvate, with the phenylalanine at position 190 replaced with the non-canonical amino acid dihydroxypropylcysteine.
PDB Compounds: (B:) n-acetylneuraminate lyase

SCOPe Domain Sequences for d5lkyb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5lkyb_ c.1.10.0 (B:) automated matches {Staphylococcus aureus [TaxId: 93061]}
dlkglyaallvpfdengqvneqglkqiaqnaieteeldglyvngssgenfllnteqkkqv
fkvakeavgdkvkliaqvgsldlneaielgkyatelgydalsavtpfyypftfeeirdyy
fdiieatqnnmiiyaipdltgvnisieqfselfnhekivgvxytapnffllerirkafpd
klilsgxdemlvqatisgvdgaigstynvngrrarkifdlarqgqiqeayqlqhdsndii
etvlsmgiyptlkeilrhrgidaglpkrpfkpfneahrqtldqliakydl

SCOPe Domain Coordinates for d5lkyb_:

Click to download the PDB-style file with coordinates for d5lkyb_.
(The format of our PDB-style files is described here.)

Timeline for d5lkyb_:

  • d5lkyb_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-23