Lineage for d5m8db2 (5m8d B:246-438)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2180205Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2180489Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) (S)
  5. 2180490Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 protein domains)
  6. 2180597Protein automated matches [227071] (5 species)
    not a true protein
  7. 2180601Species Cow (Bos taurus) [TaxId:9913] [226565] (43 PDB entries)
  8. 2288411Domain d5m8db2: 5m8d B:246-438 [331712]
    Other proteins in same PDB: d5m8da1, d5m8db1, d5m8dc1, d5m8dd1, d5m8de_, d5m8df1, d5m8df2, d5m8df3
    automated match to d3rycd2
    complexed with acp, ca, gdp, gol, gtp, mes, mg, ugi

Details for d5m8db2

PDB Entry: 5m8d (more details), 2.25 Å

PDB Description: tubulin mtd265-r1 complex
PDB Compounds: (B:) Tubulin beta-2B chain

SCOPe Domain Sequences for d5m8db2:

Sequence, based on SEQRES records: (download)

>d5m8db2 d.79.2.1 (B:246-438) automated matches {Cow (Bos taurus) [TaxId: 9913]}
gqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdsknmmaac
dprhgryltvaaifrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkm
satfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyq
qyqda

Sequence, based on observed residues (ATOM records): (download)

>d5m8db2 d.79.2.1 (B:246-438) automated matches {Cow (Bos taurus) [TaxId: 9913]}
gqlnadlrklavnmvpfprlhffmpgfapltsqyraltvpeltqqmfdsknmmaacdprh
gryltvaaifrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkmsatf
ignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyqqyqd
a

SCOPe Domain Coordinates for d5m8db2:

Click to download the PDB-style file with coordinates for d5m8db2.
(The format of our PDB-style files is described here.)

Timeline for d5m8db2:

  • d5m8db2 appears in periodic updates to SCOPe 2.06 starting on 2017-03-23