Lineage for d5m8db1 (5m8d B:2-245)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2107739Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2107740Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) (S)
    automatically mapped to Pfam PF00091
  5. 2107741Family c.32.1.1: Tubulin, GTPase domain [52491] (4 protein domains)
  6. 2107851Protein automated matches [226837] (7 species)
    not a true protein
  7. 2107855Species Cow (Bos taurus) [TaxId:9913] [226564] (43 PDB entries)
  8. 2288410Domain d5m8db1: 5m8d B:2-245 [331711]
    Other proteins in same PDB: d5m8da2, d5m8db2, d5m8dc2, d5m8dd2, d5m8de_, d5m8df1, d5m8df2, d5m8df3
    automated match to d4drxb1
    complexed with acp, ca, gdp, gol, gtp, mes, mg, ugi

Details for d5m8db1

PDB Entry: 5m8d (more details), 2.25 Å

PDB Description: tubulin mtd265-r1 complex
PDB Compounds: (B:) Tubulin beta-2B chain

SCOPe Domain Sequences for d5m8db1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5m8db1 c.32.1.1 (B:2-245) automated matches {Cow (Bos taurus) [TaxId: 9913]}
reivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneatgnkyvp
railvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvvr
kesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvmpspkvsdtvve
pynatlsvhqlventdetycidnealydicfrtlklttptygdlnhlvsatmsgvttclr
fp

SCOPe Domain Coordinates for d5m8db1:

Click to download the PDB-style file with coordinates for d5m8db1.
(The format of our PDB-style files is described here.)

Timeline for d5m8db1:

  • d5m8db1 appears in periodic updates to SCOPe 2.06 starting on 2017-03-23