SCOP 1.57: Domain d1blle1: 1bll E:1-159

Lineage for d1blle1 (1bll E:1-159)

1. Root: SCOP 1.57

2. Class c: Alpha and beta proteins (a/b) [51349] (107 folds)

3. Fold c.50: Leucine aminopeptidase, N-terminal domain [52948] (1 superfamily)

4. Superfamily c.50.1: Leucine aminopeptidase, N-terminal domain [52949] (1 family)

5. Family c.50.1.1: Leucine aminopeptidase, N-terminal domain [52950] (1 protein)

6. Protein Leucine aminopeptidase, N-terminal domain [52951] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [52952] (7 PDB entries)

8. Domain d1blle1: 1bll E:1-159 [33170]
   Other proteins in same PDB: d1blle2

Details for d1blle1

PDB Entry: 1bll, 2.4 Å

PDB Description: x-ray crystallographic determination of the structure of bovine lens leucine aminopeptidase complexed with amastatin: formulation of a catalytic mechanism featuring a gem-diolate transition state

SCOP Domain Sequences for d1blle1:

Sequence, based on SEQRES records:

>d1blle1 c.50.1.1 (E:1-159) Leucine aminopeptidase, N-terminal domain {Cow (Bos taurus)}
tkglvlgiyskekeedepqftsagenfnklvsgklreilnisgpplkagktrtfyglhed
fpsvvvvglgkktagideqenwhegkeniraavaagcrqiqdleipsvevdpcgdaqaaa
egavlglyeyddlkqkrkvvvsaklhgsedqeawqrgvl

Sequence, based on observed residues (ATOM records):

>d1blle1 c.50.1.1 (E:1-159) Leucine aminopeptidase, N-terminal domain {Cow (Bos taurus)}
tkglvlgiyskedepqftsagenfnklvsgklreilnisgpplkagktrtfyglhedfps
vvvvglgkktagideqenwhegkeniraavaagcrqiqdleipsvevdpcgdaqaaaega
vlglyeyddlkqkrkvvvsaklhgsedqeawqrgvl

Timeline for d1blle1:

• d1blle1 first appeared (with stable ids) in SCOP 1.55
  
• d1blle1 appears in SCOP 1.59
  
• d1blle1 appears in the current release, SCOPe 2.08