Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies) main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest |
Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) |
Family c.67.1.0: automated matches [191328] (1 protein) not a true family |
Protein automated matches [190151] (160 species) not a true protein |
Species Pseudomonas sp. [TaxId:306] [315480] (7 PDB entries) |
Domain d5lh9b_: 5lh9 B: [331699] automated match to d3drda_ complexed with plp |
PDB Entry: 5lh9 (more details), 1.95 Å
SCOPe Domain Sequences for d5lh9b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5lh9b_ c.67.1.0 (B:) automated matches {Pseudomonas sp. [TaxId: 306]} ekyknaekkfwhpmgssaaphrdktlviargdgnyitdidgqrmldgvgglwnvnighnr asvkaaiaaqldelayyqtfdgiahprvfdlaerltgmfaqermarvlfssggsdaveta lkmarqywiasgepgrtrflslrngyhgvhmggtsvggngvyhynhgqllagchlldtpw lyrnpwdcrdpqaltahcirqleeqiallgaqtiaaliaepvqgaggvivppadywprlr evcdrhgilliadevvtgfgrsgcmlgsrgwgvapdilclakgitagyiplgatlfnqri adaiengqgfshmimhgytysghptacaaalavldiveaedlpgnaakvgaqlleqlqpl veryavvgevrgkglmialdlvsdkrtrqpldpaagqpsriadearragvlvrpignkii lsppltltrdeaglmvsaleaafarcg
Timeline for d5lh9b_: