Lineage for d5b3sv1 (5b3s V:2-73)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2630215Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2630428Superfamily f.23.3: Mitochondrial cytochrome c oxidase subunit VIc [81415] (1 family) (S)
    automatically mapped to Pfam PF02937
  5. 2630429Family f.23.3.1: Mitochondrial cytochrome c oxidase subunit VIc [81414] (1 protein)
  6. 2630430Protein Mitochondrial cytochrome c oxidase subunit VIc [81413] (1 species)
    function unknown, probably acts as a regulator or is required for the assembly
  7. 2630431Species Cow (Bos taurus) [TaxId:9913] [81412] (52 PDB entries)
  8. 2630469Domain d5b3sv1: 5b3s V:2-73 [331698]
    Other proteins in same PDB: d5b3sa1, d5b3sa2, d5b3sb1, d5b3sb2, d5b3sb3, d5b3sc_, d5b3sd_, d5b3se_, d5b3sf_, d5b3sg_, d5b3sh_, d5b3si2, d5b3sj_, d5b3sk_, d5b3sl_, d5b3sm_, d5b3sn1, d5b3sn2, d5b3so1, d5b3so2, d5b3so3, d5b3sp_, d5b3sq_, d5b3sr_, d5b3ss_, d5b3st_, d5b3su_, d5b3sv2, d5b3sw_, d5b3sx_, d5b3sy_, d5b3sz_
    automated match to d1v54i_
    complexed with cdl, chd, cmo, cu, cua, dmu, edo, hea, mg, na, pek, pgv, psc, tgl, zn

Details for d5b3sv1

PDB Entry: 5b3s (more details), 1.68 Å

PDB Description: bovine heart cytochrome c oxidase in the carbon monoxide-bound mixed- valence state at 1.68 angstrom resolution (50 k)
PDB Compounds: (V:) Cytochrome c oxidase subunit 6C

SCOPe Domain Sequences for d5b3sv1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5b3sv1 f.23.3.1 (V:2-73) Mitochondrial cytochrome c oxidase subunit VIc {Cow (Bos taurus) [TaxId: 9913]}
talakpqmrgllarrlrfhivgafmvslgfatfykfavaekrkkayadfyrnydsmkdfe
emrkagifqsak

SCOPe Domain Coordinates for d5b3sv1:

Click to download the PDB-style file with coordinates for d5b3sv1.
(The format of our PDB-style files is described here.)

Timeline for d5b3sv1: