Lineage for d5m8df1 (5m8d F:1-76)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2106806Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
    3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
    possible rudiment form of Rossmann-fold domain
  4. 2106807Superfamily c.30.1: PreATP-grasp domain [52440] (10 families) (S)
    precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function
  5. 2107090Family c.30.1.9: Tubulin tyrosine ligase (TTL) N-terminal domain-like [310625] (1 protein)
  6. 2107091Protein Tubulin tyrosine ligase (TTL) N-terminal domain [310727] (2 species)
  7. 2107092Species Chicken (Gallus gallus) [TaxId:9031] [311384] (45 PDB entries)
  8. 2288395Domain d5m8df1: 5m8d F:1-76 [331696]
    Other proteins in same PDB: d5m8da1, d5m8da2, d5m8db1, d5m8db2, d5m8dc1, d5m8dc2, d5m8dd1, d5m8dd2, d5m8de_, d5m8df2, d5m8df3
    automated match to d3tiia1
    complexed with acp, ca, gdp, gol, gtp, mes, mg, ugi

Details for d5m8df1

PDB Entry: 5m8d (more details), 2.25 Å

PDB Description: tubulin mtd265-r1 complex
PDB Compounds: (F:) Tubulin-tyrosine ligase

SCOPe Domain Sequences for d5m8df1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5m8df1 c.30.1.9 (F:1-76) Tubulin tyrosine ligase (TTL) N-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}
mytfvvrdenssvyaevsrlllatgqwkrlrkdnprfnlmlgernrlpfgrlghepglvq
lvnyyrgadklcrkas

SCOPe Domain Coordinates for d5m8df1:

Click to download the PDB-style file with coordinates for d5m8df1.
(The format of our PDB-style files is described here.)

Timeline for d5m8df1:

  • d5m8df1 appears in periodic updates to SCOPe 2.06 starting on 2017-03-23