SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5h2bb2 (5h2b B:109-211)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2020524Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 protein domains)
  6. 2024392Protein automated matches [190374] (13 species)
    not a true protein
  7. 2025381Species Mouse (Mus musculus) [TaxId:10090] [224855] (466 PDB entries)
  8. 2288393Domain d5h2bb2: 5h2b B:109-211 [331694]
    Other proteins in same PDB: d5h2bb1
    automated match to d1igcl2

Details for d5h2bb2

PDB Entry: 5h2b (more details), 2 Å

PDB Description: structure of a novel antibody g196
PDB Compounds: (B:) G196 antibody Light chain

SCOPe Domain Sequences for d5h2bb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5h2bb2 b.1.1.2 (B:109-211) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
adaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqds
kdstysmsstltltkdeyerhnsytceathktstspivksfnr

SCOPe Domain Coordinates for d5h2bb2:

Click to download the PDB-style file with coordinates for d5h2bb2.
(The format of our PDB-style files is described here.)

Timeline for d5h2bb2:

  • d5h2bb2 appears in periodic updates to SCOPe 2.06 starting on 2017-03-23