Lineage for d5h2bb2 (5h2b B:109-211)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2020524Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 protein domains)
  6. 2024392Protein automated matches [190374] (14 species)
    not a true protein
  7. 2025381Species Mouse (Mus musculus) [TaxId:10090] [224855] (494 PDB entries)
  8. 2288393Domain d5h2bb2: 5h2b B:109-211 [331694]
    Other proteins in same PDB: d5h2bb1
    automated match to d1igcl2

Details for d5h2bb2

PDB Entry: 5h2b (more details), 2 Å

PDB Description: structure of a novel antibody g196
PDB Compounds: (B:) G196 antibody Light chain

SCOPe Domain Sequences for d5h2bb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5h2bb2 b.1.1.2 (B:109-211) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
adaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqds
kdstysmsstltltkdeyerhnsytceathktstspivksfnr

SCOPe Domain Coordinates for d5h2bb2:

Click to download the PDB-style file with coordinates for d5h2bb2.
(The format of our PDB-style files is described here.)

Timeline for d5h2bb2:

  • d5h2bb2 appears in periodic updates to SCOPe 2.06 starting on 2017-03-23