SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5h2bb1 (5h2b B:1-108)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2017117Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 protein domains)
  6. 2019634Protein automated matches [190119] (21 species)
    not a true protein
  7. 2020203Species Mouse (Mus musculus) [TaxId:10090] [186842] (149 PDB entries)
  8. 2288392Domain d5h2bb1: 5h2b B:1-108 [331693]
    Other proteins in same PDB: d5h2bb2
    automated match to d1igcl1

Details for d5h2bb1

PDB Entry: 5h2b (more details), 2 Å

PDB Description: structure of a novel antibody g196
PDB Compounds: (B:) G196 antibody Light chain

SCOPe Domain Sequences for d5h2bb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5h2bb1 b.1.1.1 (B:1-108) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
nivmtqspksmsmsvgervtltckasenvvtyvswyqqkpeqspklliygasnrytgvpd
rftgsgsatdftltissvqaedladyhcgqgysypytfgggtkleikr

SCOPe Domain Coordinates for d5h2bb1:

Click to download the PDB-style file with coordinates for d5h2bb1.
(The format of our PDB-style files is described here.)

Timeline for d5h2bb1:

  • d5h2bb1 appears in periodic updates to SCOPe 2.06 starting on 2017-03-23