Lineage for d5m8de_ (5m8d E:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2012335Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
    not a true fold
  4. 2012522Superfamily a.137.10: Stathmin [101494] (1 family) (S)
    single long helix crosslinking four tubulin subunits
    automatically mapped to Pfam PF00836
  5. 2012523Family a.137.10.1: Stathmin [101495] (2 protein domains)
  6. 2012524Protein Stathmin 4 [101496] (1 species)
  7. 2012525Species Norway rat (Rattus norvegicus) [TaxId:10116] [101497] (56 PDB entries)
  8. 2288391Domain d5m8de_: 5m8d E: [331692]
    Other proteins in same PDB: d5m8da1, d5m8da2, d5m8db1, d5m8db2, d5m8dc1, d5m8dc2, d5m8dd1, d5m8dd2, d5m8df1, d5m8df2, d5m8df3
    automated match to d4i55e_
    complexed with acp, ca, gdp, gol, gtp, mes, mg, ugi

Details for d5m8de_

PDB Entry: 5m8d (more details), 2.25 Å

PDB Description: tubulin mtd265-r1 complex
PDB Compounds: (E:) Stathmin-4

SCOPe Domain Sequences for d5m8de_:

Sequence, based on SEQRES records: (download)

>d5m8de_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mevielnkctsgqsfevilkppsfdgvpefnaslprrrdpsleeiqkkleaaeerrkyqe
aellkhlaekrehereviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqe
kdkhaeevrknkelkeea

Sequence, based on observed residues (ATOM records): (download)

>d5m8de_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mevielnkctsgqsfevilkppsdpsleeiqkkleaaeerrkyqeaellkhlaekreher
eviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqekdkhaeevrknkelk
eea

SCOPe Domain Coordinates for d5m8de_:

Click to download the PDB-style file with coordinates for d5m8de_.
(The format of our PDB-style files is described here.)

Timeline for d5m8de_:

  • d5m8de_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-23