SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5m8de_ (5m8d E:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2012335Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
    not a true fold
  4. 2012522Superfamily a.137.10: Stathmin [101494] (1 family) (S)
    single long helix crosslinking four tubulin subunits
    automatically mapped to Pfam PF00836
  5. 2012523Family a.137.10.1: Stathmin [101495] (2 protein domains)
  6. 2012524Protein Stathmin 4 [101496] (1 species)
  7. 2012525Species Norway rat (Rattus norvegicus) [TaxId:10116] [101497] (54 PDB entries)
  8. 2288391Domain d5m8de_: 5m8d E: [331692]
    Other proteins in same PDB: d5m8da1, d5m8da2, d5m8db1, d5m8db2, d5m8dc1, d5m8dc2, d5m8dd1, d5m8dd2, d5m8df1, d5m8df2, d5m8df3
    automated match to d4i55e_
    complexed with acp, ca, gdp, gol, gtp, mes, mg, ugi

Details for d5m8de_

PDB Entry: 5m8d (more details), 2.25 Å

PDB Description: tubulin mtd265-r1 complex
PDB Compounds: (E:) Stathmin-4

SCOPe Domain Sequences for d5m8de_:

Sequence, based on SEQRES records: (download)

>d5m8de_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mevielnkctsgqsfevilkppsfdgvpefnaslprrrdpsleeiqkkleaaeerrkyqe
aellkhlaekrehereviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqe
kdkhaeevrknkelkeea

Sequence, based on observed residues (ATOM records): (download)

>d5m8de_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mevielnkctsgqsfevilkppsdpsleeiqkkleaaeerrkyqeaellkhlaekreher
eviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqekdkhaeevrknkelk
eea

SCOPe Domain Coordinates for d5m8de_:

Click to download the PDB-style file with coordinates for d5m8de_.
(The format of our PDB-style files is described here.)

Timeline for d5m8de_:

  • d5m8de_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-23