SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5lh9a_ (5lh9 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130990Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2130991Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2132229Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2132230Protein automated matches [190151] (119 species)
    not a true protein
  7. 2272179Species Pseudomonas sp. [TaxId:306] [315480] (5 PDB entries)
  8. 2288388Domain d5lh9a_: 5lh9 A: [331689]
    automated match to d3drda_
    complexed with plp

Details for d5lh9a_

PDB Entry: 5lh9 (more details), 1.95 Å

PDB Description: amine transaminase crystal structure from an uncultivated pseudomonas species in the plp-bound (internal aldimine) form
PDB Compounds: (A:) omega transaminase

SCOPe Domain Sequences for d5lh9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5lh9a_ c.67.1.0 (A:) automated matches {Pseudomonas sp. [TaxId: 306]}
knaekkfwhpmgssaaphrdktlviargdgnyitdidgqrmldgvgglwnvnighnrasv
kaaiaaqldelayyqtfdgiahprvfdlaerltgmfaqermarvlfssggsdavetalkm
arqywiasgepgrtrflslrngyhgvhmggtsvggngvyhynhgqllagchlldtpwlyr
npwdcrdpqaltahcirqleeqiallgaqtiaaliaepvqgaggvivppadywprlrevc
drhgilliadevvtgfgrsgcmlgsrgwgvapdilclakgitagyiplgatlfnqriada
iengqgfshmimhgytysghptacaaalavldiveaedlpgnaakvgaqlleqlqplver
yavvgevrgkglmialdlvsdkrtrqpldpaagqpsriadearragvlvrpignkiilsp
pltltrdeaglmvsaleaafarcg

SCOPe Domain Coordinates for d5lh9a_:

Click to download the PDB-style file with coordinates for d5lh9a_.
(The format of our PDB-style files is described here.)

Timeline for d5lh9a_:

  • d5lh9a_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-23