SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5lhad_ (5lha D:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130990Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2130991Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2132229Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2132230Protein automated matches [190151] (118 species)
    not a true protein
  7. 2272179Species Pseudomonas sp. [TaxId:306] [315480] (5 PDB entries)
  8. 2288383Domain d5lhad_: 5lha D: [331684]
    automated match to d3drda_
    complexed with pmp

Details for d5lhad_

PDB Entry: 5lha (more details), 1.89 Å

PDB Description: amine transaminase crystal structure from an uncultivated pseudomonas species in the pmp-bound form
PDB Compounds: (D:) omega transaminase

SCOPe Domain Sequences for d5lhad_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5lhad_ c.67.1.0 (D:) automated matches {Pseudomonas sp. [TaxId: 306]}
kyknaekkfwhpmgssaaphrdktlviargdgnyitdidgqrmldgvgglwnvnighnra
svkaaiaaqldelayyqtfdgiahprvfdlaerltgmfaqermarvlfssggsdavetal
kmarqywiasgepgrtrflslrngyhgvhmggtsvggngvyhynhgqllagchlldtpwl
yrnpwdcrdpqaltahcirqleeqiallgaqtiaaliaepvqgaggvivppadywprlre
vcdrhgilliadevvtgfgrsgcmlgsrgwgvapdilclakgitagyiplgatlfnqria
daiengqgfshmimhgytysghptacaaalavldiveaedlpgnaakvgaqlleqlqplv
eryavvgevrgkglmialdlvsdkrtrqpldpaagqpsriadearragvlvrpignkiil
sppltltrdeaglmvsaleaafarcg

SCOPe Domain Coordinates for d5lhad_:

Click to download the PDB-style file with coordinates for d5lhad_.
(The format of our PDB-style files is described here.)

Timeline for d5lhad_:

  • d5lhad_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-23