SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5ixgb_ (5ixg B:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2063610Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 2064238Superfamily b.61.6: YceI-like [101874] (2 families) (S)
  5. 2064250Family b.61.6.0: automated matches [191627] (1 protein)
    not a true family
  6. 2064251Protein automated matches [191150] (2 species)
    not a true protein
  7. 2288361Species Burkholderia cenocepacia [TaxId:350702] [331662] (1 PDB entry)
  8. 2288382Domain d5ixgb_: 5ixg B: [331683]
    automated match to d1y0ga_
    complexed with otp, peg

Details for d5ixgb_

PDB Entry: 5ixg (more details), 1.6 Å

PDB Description: crystal structure of burkholderia cenocepacia bcnb
PDB Compounds: (B:) YceI

SCOPe Domain Sequences for d5ixgb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ixgb_ b.61.6.0 (B:) automated matches {Burkholderia cenocepacia [TaxId: 350702]}
satyqfdpshtypsfeadhfgglsvwrgkfdkssgtvtldraaktgtvdvttdiasihtg
sakldehlqtaeffdaakfpqanykgtikfdgdkpvsvvgnltlhgvtkpltlkidsfkc
mphpmlkrevcgvdavgefsrddfgldygkqygfkmktkllitaeavkq

SCOPe Domain Coordinates for d5ixgb_:

Click to download the PDB-style file with coordinates for d5ixgb_.
(The format of our PDB-style files is described here.)

Timeline for d5ixgb_:

  • d5ixgb_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-23