Lineage for d5l4nc_ (5l4n C:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2090218Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2090219Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2090553Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 protein domains)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 2090925Protein Dihydropteridin reductase (pteridine reductase) [51769] (7 species)
  7. 2090928Species Leishmania major [TaxId:5664] [63926] (13 PDB entries)
    Uniprot Q01782
  8. 2288380Domain d5l4nc_: 5l4n C: [331681]
    automated match to d1e92b_
    complexed with 6qt, act, edo, gol, ndp, peg, pge

Details for d5l4nc_

PDB Entry: 5l4n (more details), 2.35 Å

PDB Description: leishmania major pteridine reductase 1 (ptr1) in complex with compound 1
PDB Compounds: (C:) pteridine reductase 1

SCOPe Domain Sequences for d5l4nc_:

Sequence, based on SEQRES records: (download)

>d5l4nc_ c.2.1.2 (C:) Dihydropteridin reductase (pteridine reductase) {Leishmania major [TaxId: 5664]}
tvpvalvtgaakrlgrsiaeglhaegyavclhyhrsaaeanalsatlnarrpnsaitvqa
dlsnvatapvsgadgsapvtlftrcaelvaacythwgrcdvlvnnassfyptpllrnded
ghepcvgdreametatadlfgsnaiapyflikafahrvagtpakhrgtnysiinmvdamt
nqpllgytiytmakgalegltrsaalelaplqirvngvgpglsvlvddmppavweghrsk
vplyqrdssaaevsdvviflcsskakyitgtcvkvdggysltra

Sequence, based on observed residues (ATOM records): (download)

>d5l4nc_ c.2.1.2 (C:) Dihydropteridin reductase (pteridine reductase) {Leishmania major [TaxId: 5664]}
tvpvalvtgaakrlgrsiaeglhaegyavclhyhrsaaeanalsatlnarrpnsaitvqa
dlsnvatapapvtlftrcaelvaacythwgrcdvlvnnassfyptpllrreametatadl
fgsnaiapyflikafahrvagtpakhrgtnysiinmvdamtnqpllgytiytmakgaleg
ltrsaalelaplqirvngvgpglsvlvddmppavweghrskvplyqrdssaaevsdvvif
lcsskakyitgtcvkvdggysltra

SCOPe Domain Coordinates for d5l4nc_:

Click to download the PDB-style file with coordinates for d5l4nc_.
(The format of our PDB-style files is described here.)

Timeline for d5l4nc_:

  • d5l4nc_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-23