Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) many members have left-handed crossover connection between strand 8 and additional strand 9 |
Family c.69.1.0: automated matches [191404] (1 protein) not a true family |
Protein automated matches [190543] (131 species) not a true protein |
Species Uncultured bacterium [TaxId:77133] [196706] (50 PDB entries) |
Domain d5iq3c_: 5iq3 C: [331678] automated match to d4j7aa_ mutant |
PDB Entry: 5iq3 (more details), 1.75 Å
SCOPe Domain Sequences for d5iq3c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5iq3c_ c.69.1.0 (C:) automated matches {Uncultured bacterium [TaxId: 77133]} lpgrlgdpsmslgtdprtdprlaaaltqlgladqaaeppvnansevadciaystaaeqaw qtlgamlgsqgepsnpvdvreetikgrggneiklyihsptghtsdsdplpcvvhthgggm viltaadanysrwrselaatglvvvgvefrnaagalgnhpfpaglhdcadaakwvasnre algistlimsgesgggnlslattmlakkegwleeiagvyaqcpyisglyaskpeelpsll endayfwdmktmgamvkpydptgenasnplawpyhasledlaglpphvisvneldplrde glahyrkllkagvstvgrtvhgtchaadcsfvdvipdvyfatvrdisafaysra
Timeline for d5iq3c_: