SCOPe 2.06: Domain d5iq2c_: 5iq2 C:

Lineage for d5iq2c_ (5iq2 C:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.0: automated matches [191404] (1 protein)
   not a true family

6. Protein automated matches [190543] (91 species)
   not a true protein

7. Species Uncultured bacterium [TaxId:77133] [196706] (23 PDB entries)

8. Domain d5iq2c_: 5iq2 C: [331673]
   automated match to d4j7aa_
   mutant

Details for d5iq2c_

PDB Entry: 5iq2, 1.78 Å

PDB Description: crystal structure of esterase mutant - l255w

PDB Compounds: (C:) esterase

SCOPe Domain Sequences for d5iq2c_:

Sequence; same for both SEQRES and ATOM records:

>d5iq2c_ c.69.1.0 (C:) automated matches {Uncultured bacterium [TaxId: 77133]}
lpgrlgdpsmslgtdprtdprlaaaltqlgladqaaeppvnansevadciaystaaeqaw
qtlfamlgsqgepsnpvdvreetikgrggneiklyihsptghtsdsdplpcvvhthgggm
viltaadanysrwrselaatglvvvgvefrnaagalgnhpfpaglhdcadaakwvasnre
algistlimsgesgggnlslattmlakkegwleeiagvyaqcpyisglyaskpeelpsll
endayfwdmktmgamvkpydptgenasnplawpyhasledlaglpphvisvneldplrde
glahyrkllkagvstvgrtvhgtchaadcsfvdvipdvyfatvrdisafaysra

Timeline for d5iq2c_:

• d5iq2c_ is new in SCOPe 2.06-stable
  
• d5iq2c_ appears in SCOPe 2.07
  
• d5iq2c_ appears in the current release, SCOPe 2.08