SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5jsya_ (5jsy A:)

  1. Root: SCOPe 2.06
  2. 2217451Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2222239Fold e.19: HydA/Nqo6-like [56769] (1 superfamily)
    2 domains: (1) alpa/beta; (2) Fe-S cluster-bound
  4. 2222240Superfamily e.19.1: HydA/Nqo6-like [56770] (3 families) (S)
  5. 2222241Family e.19.1.1: Nickel-iron hydrogenase, small subunit [56771] (2 protein domains)
  6. 2222271Protein automated matches [190110] (7 species)
    not a true protein
  7. 2222348Species Desulfovibrio vulgaris [TaxId:882] [197352] (11 PDB entries)
  8. 2288370Domain d5jsya_: 5jsy A: [331671]
    automated match to d3ze9a_
    complexed with cl, fco, fe2, h2s, ni, sf4

Details for d5jsya_

PDB Entry: 5jsy (more details), 1.04 Å

PDB Description: the 3d structure of the ni-reconstituted u489c variant of [nifese] hydrogenase from desulfovibrio vulgaris hildenborough at 1.04 angstrom resolution
PDB Compounds: (A:) periplasmic [nifese] hydrogenase, small subunit

SCOPe Domain Sequences for d5jsya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jsya_ e.19.1.1 (A:) automated matches {Desulfovibrio vulgaris [TaxId: 882]}
gtltgerppvfwlqgqgctgcsvtllnsvhpsiadvllkvislefhptvmawegehaieh
mrkvaekfkgkfflviegsvpveadgkyciigeanhheismvdalkefgpnaaavlavgt
caayggipaaegsetgatavskflgdngiktpvvnipgcpphpdwivgtvvlaldaikkn
glegglaevvkvldsdgrptpffgrnihencpyldkydegvmsatftdkvgcrydlgckg
pmtmadcferkwnggvnwcvqnavcigcvepdfpdgkspfyqa

SCOPe Domain Coordinates for d5jsya_:

Click to download the PDB-style file with coordinates for d5jsya_.
(The format of our PDB-style files is described here.)

Timeline for d5jsya_:

  • d5jsya_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-23