SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5jt1a_ (5jt1 A:)

  1. Root: SCOPe 2.06
  2. 2217451Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2222239Fold e.19: HydA/Nqo6-like [56769] (1 superfamily)
    2 domains: (1) alpa/beta; (2) Fe-S cluster-bound
  4. 2222240Superfamily e.19.1: HydA/Nqo6-like [56770] (3 families) (S)
  5. 2222241Family e.19.1.1: Nickel-iron hydrogenase, small subunit [56771] (2 protein domains)
  6. 2222271Protein automated matches [190110] (7 species)
    not a true protein
  7. 2222348Species Desulfovibrio vulgaris [TaxId:882] [197352] (11 PDB entries)
  8. 2288367Domain d5jt1a_: 5jt1 A: [331668]
    automated match to d3ze9a_
    complexed with 6ml, fco, fe2, h2s, ni, sf4

Details for d5jt1a_

PDB Entry: 5jt1 (more details), 1.35 Å

PDB Description: the 3d structure of ni-reconstituted u489c variant of [nifese] hydrogenase from desulfovibrio vulgaris hildenborough in the oxidized state at 1.35 angstrom resolution
PDB Compounds: (A:) periplasmic [nifese] hydrogenase, small subunit

SCOPe Domain Sequences for d5jt1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jt1a_ e.19.1.1 (A:) automated matches {Desulfovibrio vulgaris [TaxId: 882]}
gtltgerppvfwlqgqgctgcsvtllnsvhpsiadvllkvislefhptvmawegehaieh
mrkvaekfkgkfflviegsvpveadgkyciigeanhheismvdalkefgpnaaavlavgt
caayggipaaegsetgatavskflgdngiktpvvnipgcpphpdwivgtvvlaldaikkn
glegglaevvkvldsdgrptpffgrnihencpyldkydegvmsatftdkvgcrydlgckg
pmtmadcferkwnggvnwcvqnavcigcvepdfpdgkspfyqa

SCOPe Domain Coordinates for d5jt1a_:

Click to download the PDB-style file with coordinates for d5jt1a_.
(The format of our PDB-style files is described here.)

Timeline for d5jt1a_:

  • d5jt1a_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-23