SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5l4nb_ (5l4n B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2090218Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2090219Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2090553Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 protein domains)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 2090925Protein Dihydropteridin reductase (pteridine reductase) [51769] (7 species)
  7. 2090928Species Leishmania major [TaxId:5664] [63926] (12 PDB entries)
    Uniprot Q01782
  8. 2288366Domain d5l4nb_: 5l4n B: [331667]
    automated match to d1e92b_
    complexed with 6qt, act, edo, gol, ndp, peg, pge

Details for d5l4nb_

PDB Entry: 5l4n (more details), 2.35 Å

PDB Description: leishmania major pteridine reductase 1 (ptr1) in complex with compound 1
PDB Compounds: (B:) pteridine reductase 1

SCOPe Domain Sequences for d5l4nb_:

Sequence, based on SEQRES records: (download)

>d5l4nb_ c.2.1.2 (B:) Dihydropteridin reductase (pteridine reductase) {Leishmania major [TaxId: 5664]}
tvpvalvtgaakrlgrsiaeglhaegyavclhyhrsaaeanalsatlnarrpnsaitvqa
dlsnvatapvsgadgsapvtlftrcaelvaacythwgrcdvlvnnassfyptpllrnded
ghepcvgdreametatadlfgsnaiapyflikafahrvagtpakhrgtnysiinmvdamt
nqpllgytiytmakgalegltrsaalelaplqirvngvgpglsvlvddmppavweghrsk
vplyqrdssaaevsdvviflcsskakyitgtcvkvdggysltra

Sequence, based on observed residues (ATOM records): (download)

>d5l4nb_ c.2.1.2 (B:) Dihydropteridin reductase (pteridine reductase) {Leishmania major [TaxId: 5664]}
tvpvalvtgaakrlgrsiaeglhaegyavclhyhrsaaeanalsatlnarrpnsaitvqa
dlsnvatapapvtlftrcaelvaacythwgrcdvlvnnassfyptpllreametatadlf
gsnaiapyflikafahrvagtpakhrgtnysiinmvdamtnqpllgytiytmakgalegl
trsaalelaplqirvngvgpglsvlvhrskvplyqrdssaaevsdvviflcsskakyitg
tcvkvdggysltra

SCOPe Domain Coordinates for d5l4nb_:

Click to download the PDB-style file with coordinates for d5l4nb_.
(The format of our PDB-style files is described here.)

Timeline for d5l4nb_:

  • d5l4nb_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-23