Lineage for d5jjqb_ (5jjq B:)

  1. Root: SCOPe 2.06
  2. 2217451Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2222543Fold e.23: Acetyl-CoA synthetase-like [56800] (1 superfamily)
    4 domains: (1&2) duplication: share the same alpha/beta fold; (3) beta-barrel; (4) alpha+beta
  4. 2222544Superfamily e.23.1: Acetyl-CoA synthetase-like [56801] (2 families) (S)
  5. 2222620Family e.23.1.0: automated matches [191594] (1 protein)
    not a true family
  6. 2222621Protein automated matches [191083] (23 species)
    not a true protein
  7. 2288323Species Streptomyces sp. [TaxId:1265536] [331624] (1 PDB entry)
  8. 2288365Domain d5jjqb_: 5jjq B: [331666]
    Other proteins in same PDB: d5jjqd2
    automated match to d4d57a_
    complexed with 6l1, cl

Details for d5jjqb_

PDB Entry: 5jjq (more details), 2.6 Å

PDB Description: crystal structure of idnl1
PDB Compounds: (B:) AMP-dependent synthetase and ligase

SCOPe Domain Sequences for d5jjqb_:

Sequence, based on SEQRES records: (download)

>d5jjqb_ e.23.1.0 (B:) automated matches {Streptomyces sp. [TaxId: 1265536]}
vftlaqnpverlheflltgarltpekpavlelsgtepgyvsyrqlanraesyaaalgglg
ldigdrvvlesdtsasaiaallacsslglpfvpvtpetpakrllavvdtvspalylqaeg
grreglpesvgtgrfgpgglvieraprpgrgfrrevapadpaymvftsgstgrpkgvvms
hrailsfyrgmlsqgivgpesrvastapfqfdfslldiglalgsgatvvpvprallrwpr
rfvrflrdseatqvngapsiwrgalrheadelaalggrirgvlfsgepfplpevralqqa
lplarivncfgstesvaasftdvprpvpdgltklsighahpgaemmlldddgvpvtepgv
tghihlrsgslftgywgdpeataralvpdptnpmtgqtvfrtgdlahrdatgelyfdgra
dnqvkirgnrvelteverrvaeftgvaaasavllpvaesdpvlavfvelspgaefdemel
gafcleelpdymapqrihvldalp

Sequence, based on observed residues (ATOM records): (download)

>d5jjqb_ e.23.1.0 (B:) automated matches {Streptomyces sp. [TaxId: 1265536]}
vftlaqnpverlheflltgarltpekpavlegyvsyrqlanraesyaaalgglgldigdr
vvlesdtsasaiaallacsslglpfvpvtpetpakrllavvdtvspalylqaeggrregl
pesvgtgrfgpgglvieraprpgrgfrrevapadpaymvfpkgvvmshrailsfyrgmls
qgivgpesrvastapfqfdfslldiglalgsgatvvpvprallrwprrfvrflrdseatq
vngapsiwrgalrheadelaalggrirgvlfsgepfplpevralqqalplarivncfgst
esvaasftdvprpvpdgltklsighahpgaemmlldddgvpvtepgvtghihlrsgslft
gywgdpeataralvpdptnpmtgqtvfrtgdlahrdatgelyfdgradnqvkirgnrvel
teverrvaeftgvaaasavllpdpvlavfvelspgaefdemelgafcleelpdymapqri
hvldalp

SCOPe Domain Coordinates for d5jjqb_:

Click to download the PDB-style file with coordinates for d5jjqb_.
(The format of our PDB-style files is described here.)

Timeline for d5jjqb_:

  • d5jjqb_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-23