Class b: All beta proteins [48724] (180 folds) |
Fold b.61: Streptavidin-like [50875] (8 superfamilies) barrel, closed; n=8, S=10; meander |
Superfamily b.61.6: YceI-like [101874] (2 families) |
Family b.61.6.0: automated matches [191627] (1 protein) not a true family |
Protein automated matches [191150] (3 species) not a true protein |
Species Burkholderia cenocepacia [TaxId:350702] [331662] (1 PDB entry) |
Domain d5ixga_: 5ixg A: [331663] automated match to d1y0ga_ complexed with otp, peg |
PDB Entry: 5ixg (more details), 1.6 Å
SCOPe Domain Sequences for d5ixga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ixga_ b.61.6.0 (A:) automated matches {Burkholderia cenocepacia [TaxId: 350702]} atyqfdpshtypsfeadhfgglsvwrgkfdkssgtvtldraaktgtvdvttdiasihtgs akldehlqtaeffdaakfpqanykgtikfdgdkpvsvvgnltlhgvtkpltlkidsfkcm phpmlkrevcgvdavgefsrddfgldygkqygfkmktkllitaeavkq
Timeline for d5ixga_: