SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5klub_ (5klu B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1980368Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 1980369Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 1980370Family a.3.1.1: monodomain cytochrome c [46627] (16 protein domains)
  6. 1980579Protein Mitochondrial cytochrome c [46642] (7 species)
  7. 1980580Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [46643] (70 PDB entries)
    Uniprot P00044
  8. 2288360Domain d5klub_: 5klu B: [331661]
    automated match to d4mu8a_
    complexed with 6uz, hem, so4

Details for d5klub_

PDB Entry: 5klu (more details), 1.99 Å

PDB Description: crystal structure of a domain-swapped dimer of yeast iso-1-cytochrome c with omega-undecylenyl-beta-d-maltopyranoside
PDB Compounds: (B:) Cytochrome c iso-1

SCOPe Domain Sequences for d5klub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5klub_ a.3.1.1 (B:) Mitochondrial cytochrome c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
fkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikknv
lwdennmseyltnpakyipgtkmafgglkkekdrndlitylkkase

SCOPe Domain Coordinates for d5klub_:

Click to download the PDB-style file with coordinates for d5klub_.
(The format of our PDB-style files is described here.)

Timeline for d5klub_:

  • d5klub_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-23