SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5ji1a_ (5ji1 A:)

  1. Root: SCOPe 2.06
  2. 2229111Class g: Small proteins [56992] (94 folds)
  3. 2232568Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
    disulfide-rich fold; common core is all-beta
  4. 2232569Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) (S)
  5. 2232868Family g.17.1.0: automated matches [191392] (1 protein)
    not a true family
  6. 2232869Protein automated matches [190506] (3 species)
    not a true protein
  7. 2232902Species Mouse (Mus musculus) [TaxId:10090] [188989] (6 PDB entries)
  8. 2288357Domain d5ji1a_: 5ji1 A: [331658]
    automated match to d3hh2a_
    complexed with mpd

Details for d5ji1a_

PDB Entry: 5ji1 (more details), 2.25 Å

PDB Description: crystal structure of gdf8
PDB Compounds: (A:) Growth/differentiation factor 8

SCOPe Domain Sequences for d5ji1a_:

Sequence, based on SEQRES records: (download)

>d5ji1a_ g.17.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dfgldcdehstesrccrypltvdfeafgwdwiiapkrykanycsgecefvflqkyphthl
vhqanprgsagpcctptkmspinmlyfngkeqiiygkipamvvdrcgcs

Sequence, based on observed residues (ATOM records): (download)

>d5ji1a_ g.17.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dfgldcdehstesrccrypltvdfeafgwdwiiapkrykanycsgecefvnprgsagpcc
tptkmspinmlyfngkeqiiygkipamvvdrcgcs

SCOPe Domain Coordinates for d5ji1a_:

Click to download the PDB-style file with coordinates for d5ji1a_.
(The format of our PDB-style files is described here.)

Timeline for d5ji1a_:

  • d5ji1a_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-23