Lineage for d5ji1a_ (5ji1 A:)

  1. Root: SCOPe 2.07
  2. 2581248Class g: Small proteins [56992] (98 folds)
  3. 2584898Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
    disulfide-rich fold; common core is all-beta
  4. 2584899Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) (S)
  5. 2585214Family g.17.1.0: automated matches [191392] (1 protein)
    not a true family
  6. 2585215Protein automated matches [190506] (3 species)
    not a true protein
  7. 2585266Species Mouse (Mus musculus) [TaxId:10090] [188989] (3 PDB entries)
  8. 2585269Domain d5ji1a_: 5ji1 A: [331658]
    automated match to d3hh2a_
    complexed with mpd

Details for d5ji1a_

PDB Entry: 5ji1 (more details), 2.25 Å

PDB Description: crystal structure of gdf8
PDB Compounds: (A:) Growth/differentiation factor 8

SCOPe Domain Sequences for d5ji1a_:

Sequence, based on SEQRES records: (download)

>d5ji1a_ g.17.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dfgldcdehstesrccrypltvdfeafgwdwiiapkrykanycsgecefvflqkyphthl
vhqanprgsagpcctptkmspinmlyfngkeqiiygkipamvvdrcgcs

Sequence, based on observed residues (ATOM records): (download)

>d5ji1a_ g.17.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dfgldcdehstesrccrypltvdfeafgwdwiiapkrykanycsgecefvnprgsagpcc
tptkmspinmlyfngkeqiiygkipamvvdrcgcs

SCOPe Domain Coordinates for d5ji1a_:

Click to download the PDB-style file with coordinates for d5ji1a_.
(The format of our PDB-style files is described here.)

Timeline for d5ji1a_: