Lineage for d5iq0b_ (5iq0 B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2134062Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2134063Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2136079Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2136080Protein automated matches [190543] (90 species)
    not a true protein
  7. 2136705Species Uncultured bacterium [TaxId:77133] [196706] (23 PDB entries)
  8. 2288355Domain d5iq0b_: 5iq0 B: [331656]
    automated match to d4j7aa_
    mutant

Details for d5iq0b_

PDB Entry: 5iq0 (more details), 1.8 Å

PDB Description: crystal structure of esterase mutant - f72g
PDB Compounds: (B:) esterase

SCOPe Domain Sequences for d5iq0b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5iq0b_ c.69.1.0 (B:) automated matches {Uncultured bacterium [TaxId: 77133]}
qlpgrlgdpsmslgtdprtdprlaaaltqlgladqaaeppvnansevadciaystaaeqa
wqtlgamlgsqgepsnpvdvreetikgrggneiklyihsptghtsdsdplpcvvhthggg
mviltaadanysrwrselaatglvvvgvefrnaagalgnhpfpaglhdcadaakwvasnr
ealgistlimsgesgggnlslattmlakkegwleeiagvyaqcpyisglyaskpeelpsl
lendayfldmktmgamvkpydptgenasnplawpyhasledlaglpphvisvneldplrd
eglahyrkllkagvstvgrtvhgtchaadcsfvdvipdvyfatvrdisafaysra

SCOPe Domain Coordinates for d5iq0b_:

Click to download the PDB-style file with coordinates for d5iq0b_.
(The format of our PDB-style files is described here.)

Timeline for d5iq0b_:

  • d5iq0b_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-23