Lineage for d5ihwa2 (5ihw A:424-591)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2363595Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2363797Superfamily b.2.3: Bacterial adhesins [49401] (7 families) (S)
  5. 2364168Family b.2.3.0: automated matches [191391] (1 protein)
    not a true family
  6. 2364169Protein automated matches [190503] (9 species)
    not a true protein
  7. 2364213Species Staphylococcus aureus [TaxId:282459] [331651] (1 PDB entry)
  8. 2364215Domain d5ihwa2: 5ihw A:424-591 [331653]
    automated match to d1r19a2

Details for d5ihwa2

PDB Entry: 5ihw (more details), 1.25 Å

PDB Description: the crystal structure of sdre from staphylococcus aureus
PDB Compounds: (A:) Serine-aspartate repeat-containing protein E

SCOPe Domain Sequences for d5ihwa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ihwa2 b.2.3.0 (A:424-591) automated matches {Staphylococcus aureus [TaxId: 282459]}
qdpmvhgdsniqsiftkldedkqtieqqiyvnplkksatntkvdiagsqvddygniklgn
gstiidqnteikvykvnsdqqlpqsnriydfsqyedvtsqfdnkksfsnnvatldfgdin
sayiikvvskytptsdgeldiaqgtsmrttdkygyynyagysnfivts

SCOPe Domain Coordinates for d5ihwa2:

Click to download the PDB-style file with coordinates for d5ihwa2.
(The format of our PDB-style files is described here.)

Timeline for d5ihwa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5ihwa1