SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5ihwa1 (5ihw A:278-423)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2033752Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2033932Superfamily b.2.3: Bacterial adhesins [49401] (7 families) (S)
  5. 2034222Family b.2.3.0: automated matches [191391] (1 protein)
    not a true family
  6. 2034223Protein automated matches [190503] (4 species)
    not a true protein
  7. 2288350Species Staphylococcus aureus [TaxId:282459] [331651] (1 PDB entry)
  8. 2288351Domain d5ihwa1: 5ihw A:278-423 [331652]
    automated match to d1r19a1

Details for d5ihwa1

PDB Entry: 5ihw (more details), 1.25 Å

PDB Description: the crystal structure of sdre from staphylococcus aureus
PDB Compounds: (A:) Serine-aspartate repeat-containing protein E

SCOPe Domain Sequences for d5ihwa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ihwa1 b.2.3.0 (A:278-423) automated matches {Staphylococcus aureus [TaxId: 282459]}
nnvndlikvtkqtikvgdgkdnvaaahdgkdieydteftidnkvkkgdtmtinydknvip
sdltdkndpiditdpsgeviakgtfdkatkqitytftdyvdkyediksrltlysyidkkt
vpnetslnltfatagketsqnvtvdy

SCOPe Domain Coordinates for d5ihwa1:

Click to download the PDB-style file with coordinates for d5ihwa1.
(The format of our PDB-style files is described here.)

Timeline for d5ihwa1:

  • d5ihwa1 appears in periodic updates to SCOPe 2.06 starting on 2017-03-23

View in 3D
Domains from same chain:
(mouse over for more information)
d5ihwa2