SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5jjqa_ (5jjq A:)

  1. Root: SCOPe 2.06
  2. 2217451Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2222543Fold e.23: Acetyl-CoA synthetase-like [56800] (1 superfamily)
    4 domains: (1&2) duplication: share the same alpha/beta fold; (3) beta-barrel; (4) alpha+beta
  4. 2222544Superfamily e.23.1: Acetyl-CoA synthetase-like [56801] (2 families) (S)
  5. 2222620Family e.23.1.0: automated matches [191594] (1 protein)
    not a true family
  6. 2222621Protein automated matches [191083] (22 species)
    not a true protein
  7. 2288323Species Streptomyces sp. [TaxId:1265536] [331624] (1 PDB entry)
  8. 2288349Domain d5jjqa_: 5jjq A: [331650]
    Other proteins in same PDB: d5jjqd2
    automated match to d4d57a_
    complexed with 6l1, cl

Details for d5jjqa_

PDB Entry: 5jjq (more details), 2.6 Å

PDB Description: crystal structure of idnl1
PDB Compounds: (A:) AMP-dependent synthetase and ligase

SCOPe Domain Sequences for d5jjqa_:

Sequence, based on SEQRES records: (download)

>d5jjqa_ e.23.1.0 (A:) automated matches {Streptomyces sp. [TaxId: 1265536]}
aqnpverlheflltgarltpekpavlelsgtepgyvsyrqlanraesyaaalgglgldig
drvvlesdtsasaiaallacsslglpfvpvtpetpakrllavvdtvspalylqaeggrre
glpesvgtgrfgpgglvieraprpgrgfrrevapadpaymvftsgstgrpkgvvmshrai
lsfyrgmlsqgivgpesrvastapfqfdfslldiglalgsgatvvpvprallrwprrfvr
flrdseatqvngapsiwrgalrheadelaalggrirgvlfsgepfplpevralqqalpla
rivncfgstesvaasftdvprpvpdgltklsighahpgaemmlldddgvpvtepgvtghi
hlrsgslftgywgdpeataralvpdptnpmtgqtvfrtgdlahrdatgelyfdgradnqv
kirgnrvelteverrvaeftgvaaasavllpvaesdpvlavfvelspgaefdemelgafc
leelpdymapqrihvldalp

Sequence, based on observed residues (ATOM records): (download)

>d5jjqa_ e.23.1.0 (A:) automated matches {Streptomyces sp. [TaxId: 1265536]}
aqnpverlheflltgarltpekpavlelsgtepgyvsyrqlanraesyaaalgglgldig
drvvlesdtsasaiaallacsslglpfvpvtpetpakrllavvdtvspalylqaeggrre
glpesvgtgrfgpgglvieraprpgrgfrrevapadpaymvftpkgvvmshrailsfyrg
mlsqgivgpesrvastapfqfdfslldiglalgsgatvvpvprallrwprrfvrflrdse
atqvngapsiwrgalrheadelaalggrirgvlfsgepfplpevralqqalplarivncf
gstesvaasftdvprpvpdgltklsighahpgaemmlldddgvpvtepgvtghihlrsgs
lftgywgdpeataralvpdptnpmtgqtvfrtgdlahrdatgelyfdgradnqvkirgnr
velteverrvaeftgvaaasavllpvlavfvelspgaefdemelgafcleelpdymapqr
ihvldalp

SCOPe Domain Coordinates for d5jjqa_:

Click to download the PDB-style file with coordinates for d5jjqa_.
(The format of our PDB-style files is described here.)

Timeline for d5jjqa_:

  • d5jjqa_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-23