Lineage for d1mabg_ (1mab G:)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 245438Fold c.49: Pyruvate kinase C-terminal domain-like [52934] (2 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145, strand 5 is antiparallel to the rest
  4. 245530Superfamily c.49.2: ATP syntase (F1-ATPase), gamma subunit [52943] (1 family) (S)
    contains an antiparallel coiled coil formed by N- anb C-terminal extensions to the common fold
  5. 245531Family c.49.2.1: ATP syntase (F1-ATPase), gamma subunit [52944] (1 protein)
  6. 245532Protein ATP syntase (F1-ATPase), gamma subunit [52945] (3 species)
  7. 245545Species Rat (Rattus norvegicus) [TaxId:10116] [52947] (1 PDB entry)
  8. 245546Domain d1mabg_: 1mab G: [33165]
    Other proteins in same PDB: d1maba1, d1maba2, d1maba3, d1mabb1, d1mabb2, d1mabb3
    partly disordered
    complexed with adp, atp, mg, po4

Details for d1mabg_

PDB Entry: 1mab (more details), 2.8 Å

PDB Description: rat liver f1-atpase

SCOP Domain Sequences for d1mabg_:

Sequence, based on SEQRES records: (download)

>d1mabg_ c.49.2.1 (G:) ATP syntase (F1-ATPase), gamma subunit {Rat (Rattus norvegicus)}
rditrrlksikniqkitksmkmvaaakyaraerelkparvygtgslalyekaeikgpedk
kkhliigvssdrglcgaihssvakqmkndmaaltaagkevmivgigekiksilyrthsdq
flvsfkdvgrkpptfgdasvialellnsgyefdegsiifnqfksvisykteekpifsfst
vvaaenmsiyddidadvlqnyqeynlaniiyyslkesttseqsarmtamdnasknasdmi
dkltltfnrtrqavitkelieiisgaaald

Sequence, based on observed residues (ATOM records): (download)

>d1mabg_ c.49.2.1 (G:) ATP syntase (F1-ATPase), gamma subunit {Rat (Rattus norvegicus)}
rditrrlksikniqkitksmkmvaaakyaraerelkparvygtgslcgaihssvakqmkl
aniiyyslkesttseqsarmtamdnasknasdmidkltltfnrtrqavitkelieiisga
aald

SCOP Domain Coordinates for d1mabg_:

Click to download the PDB-style file with coordinates for d1mabg_.
(The format of our PDB-style files is described here.)

Timeline for d1mabg_: