Lineage for d5jska_ (5jsk A:)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3019032Fold e.19: HydA/Nqo6-like [56769] (1 superfamily)
    2 domains: (1) alpa/beta; (2) Fe-S cluster-bound
  4. 3019033Superfamily e.19.1: HydA/Nqo6-like [56770] (3 families) (S)
  5. 3019034Family e.19.1.1: Nickel-iron hydrogenase, small subunit [56771] (2 proteins)
  6. 3019069Protein automated matches [190110] (7 species)
    not a true protein
  7. 3019149Species Desulfovibrio vulgaris [TaxId:882] [197352] (21 PDB entries)
  8. 3019151Domain d5jska_: 5jsk A: [331648]
    automated match to d3ze9a_
    complexed with fco, fe2, gol, h2s, ni, sf4

Details for d5jska_

PDB Entry: 5jsk (more details), 0.95 Å

PDB Description: the 3d structure of [nifese] hydrogenase from desulfovibrio vulgaris hildenborough in the reduced state at 0.95 angstrom resolution
PDB Compounds: (A:) periplasmic [nifese] hydrogenase, small subunit

SCOPe Domain Sequences for d5jska_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jska_ e.19.1.1 (A:) automated matches {Desulfovibrio vulgaris [TaxId: 882]}
gtltgerppvfwlqgqgctgcsvtllnsvhpsiadvllkvislefhptvmawegehaieh
mrkvaekfkgkfflviegsvpveadgkyciigeanhheismvdalkefgpnaaavlavgt
caayggipaaegsetgatavskflgdngiktpvvnipgcpphpdwivgtvvlaldaikkn
glegglaevvkvldsdgrptpffgrnihencpyldkydegvmsatftdkvgcrydlgckg
pmtmadcferkwnggvnwcvqnavcigcvepdfpdgkspfyqa

SCOPe Domain Coordinates for d5jska_:

Click to download the PDB-style file with coordinates for d5jska_.
(The format of our PDB-style files is described here.)

Timeline for d5jska_: