Class b: All beta proteins [48724] (177 folds) |
Fold b.52: Double psi beta-barrel [50684] (2 superfamilies) barrel, closed; n=6, S=10; complex topology with crossover (psi) loops |
Superfamily b.52.1: Barwin-like endoglucanases [50685] (5 families) |
Family b.52.1.0: automated matches [227180] (1 protein) not a true family |
Protein automated matches [226899] (3 species) not a true protein |
Species Cryptopygus antarcticus [TaxId:187623] [331634] (1 PDB entry) |
Domain d5h4ub1: 5h4u B:1-207 [331646] Other proteins in same PDB: d5h4ua2, d5h4ub2, d5h4uc2 automated match to d1hd5a_ |
PDB Entry: 5h4u (more details), 2.6 Å
SCOPe Domain Sequences for d5h4ub1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5h4ub1 b.52.1.0 (B:1-207) automated matches {Cryptopygus antarcticus [TaxId: 187623]} ltsgsgvttrywdcckpscswggkasvtkpvrtckangnttidsntqsgcnggssyvcnd qqpftqgnvgygfaaasisgqpesqtccacyemtftntaisgqkmivqvtntgsdlngnh fdlmipgggvgifngcqsqwgapsngwgqryggissqsecnqlptslragcnwrfgwfkn adnpsmkftqvrcptiltqksqcvrtp
Timeline for d5h4ub1:
View in 3D Domains from other chains: (mouse over for more information) d5h4ua1, d5h4ua2, d5h4uc1, d5h4uc2 |