SCOPe 2.08: Domain d5h4ub1: 5h4u B:1-207

Lineage for d5h4ub1 (5h4u B:1-207)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.52: Double psi beta-barrel [50684] (2 superfamilies)
   barrel, closed; n=6, S=10; complex topology with crossover (psi) loops

4. Superfamily b.52.1: Barwin-like endoglucanases [50685] (5 families)

5. Family b.52.1.0: automated matches [227180] (1 protein)
   not a true family

6. Protein automated matches [226899] (4 species)
   not a true protein

7. Species Cryptopygus antarcticus [TaxId:187623] [331634] (1 PDB entry)

8. Domain d5h4ub1: 5h4u B:1-207 [331646]
   Other proteins in same PDB: d5h4ua2, d5h4ub2, d5h4uc2
   automated match to d1hd5a_

Details for d5h4ub1

PDB Entry: 5h4u, 2.6 Å

PDB Description: crystal structure of cellulase from antarctic springtail, cryptopygus antarcticus

PDB Compounds: (B:) endo-beta-1,4-glucanase

SCOPe Domain Sequences for d5h4ub1:

Sequence; same for both SEQRES and ATOM records:

>d5h4ub1 b.52.1.0 (B:1-207) automated matches {Cryptopygus antarcticus [TaxId: 187623]}
ltsgsgvttrywdcckpscswggkasvtkpvrtckangnttidsntqsgcnggssyvcnd
qqpftqgnvgygfaaasisgqpesqtccacyemtftntaisgqkmivqvtntgsdlngnh
fdlmipgggvgifngcqsqwgapsngwgqryggissqsecnqlptslragcnwrfgwfkn
adnpsmkftqvrcptiltqksqcvrtp

Timeline for d5h4ub1:

• d5h4ub1 first appeared in SCOPe 2.06
  
• d5h4ub1 appears in SCOPe 2.07