SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5h4ub1 (5h4u B:1-207)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2061141Fold b.52: Double psi beta-barrel [50684] (2 superfamilies)
    barrel, closed; n=6, S=10; complex topology with crossover (psi) loops
  4. 2061142Superfamily b.52.1: Barwin-like endoglucanases [50685] (5 families) (S)
  5. 2061188Family b.52.1.0: automated matches [227180] (1 protein)
    not a true family
  6. 2061189Protein automated matches [226899] (3 species)
    not a true protein
  7. 2288333Species Cryptopygus antarcticus [TaxId:187623] [331634] (1 PDB entry)
  8. 2288345Domain d5h4ub1: 5h4u B:1-207 [331646]
    Other proteins in same PDB: d5h4ua2, d5h4ub2, d5h4uc2
    automated match to d1hd5a_

Details for d5h4ub1

PDB Entry: 5h4u (more details), 2.6 Å

PDB Description: crystal structure of cellulase from antarctic springtail, cryptopygus antarcticus
PDB Compounds: (B:) endo-beta-1,4-glucanase

SCOPe Domain Sequences for d5h4ub1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5h4ub1 b.52.1.0 (B:1-207) automated matches {Cryptopygus antarcticus [TaxId: 187623]}
ltsgsgvttrywdcckpscswggkasvtkpvrtckangnttidsntqsgcnggssyvcnd
qqpftqgnvgygfaaasisgqpesqtccacyemtftntaisgqkmivqvtntgsdlngnh
fdlmipgggvgifngcqsqwgapsngwgqryggissqsecnqlptslragcnwrfgwfkn
adnpsmkftqvrcptiltqksqcvrtp

SCOPe Domain Coordinates for d5h4ub1:

Click to download the PDB-style file with coordinates for d5h4ub1.
(The format of our PDB-style files is described here.)

Timeline for d5h4ub1:

  • d5h4ub1 appears in periodic updates to SCOPe 2.06 starting on 2017-03-23