Lineage for d1cowg_ (1cow G:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1170081Fold c.49: Pyruvate kinase C-terminal domain-like [52934] (2 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145, strand 5 is antiparallel to the rest
  4. 1170197Superfamily c.49.2: ATP synthase (F1-ATPase), gamma subunit [52943] (2 families) (S)
    contains an antiparallel coiled coil formed by N- and C-terminal extensions to the common fold
  5. 1170198Family c.49.2.1: ATP synthase (F1-ATPase), gamma subunit [52944] (1 protein)
  6. 1170199Protein ATP synthase (F1-ATPase), gamma subunit [52945] (3 species)
  7. 1170200Species Cow (Bos taurus) [TaxId:9913] [52946] (19 PDB entries)
    Uniprot P05631
  8. 1170222Domain d1cowg_: 1cow G: [33164]
    Other proteins in same PDB: d1cowa1, d1cowa2, d1cowa3, d1cowb1, d1cowb2, d1cowb3, d1cowc1, d1cowc2, d1cowc3, d1cowd1, d1cowd2, d1cowd3, d1cowe1, d1cowe2, d1cowe3, d1cowf1, d1cowf2, d1cowf3
    core domain is disordered; only coiled coil part is visible
    complexed with adp, anp, aur, mg

Details for d1cowg_

PDB Entry: 1cow (more details), 3.1 Å

PDB Description: bovine mitochondrial f1-atpase complexed with aurovertin b
PDB Compounds: (G:) bovine mitochondrial f1-ATPase

SCOPe Domain Sequences for d1cowg_:

Sequence, based on SEQRES records: (download)

>d1cowg_ c.49.2.1 (G:) ATP synthase (F1-ATPase), gamma subunit {Cow (Bos taurus) [TaxId: 9913]}
atlkditrrlksikniqkitksmkmvaaakyaraerelkparvygvgslalyekadiktp
edkkkhliigvssdrglcgaihssvakqmkseaanlaaagkevkiigvgdkirsilhrth
sdqflvtfkevgrrpptfgdasvialellnsgyefdegsiifnrfrsvisykteekpifs
ldtissaesmsiyddidadvlrnyqeyslaniiyyslkesttseqsarmtamdnasknas
emidkltltfnrtrqavitkelieiisgaaal

Sequence, based on observed residues (ATOM records): (download)

>d1cowg_ c.49.2.1 (G:) ATP synthase (F1-ATPase), gamma subunit {Cow (Bos taurus) [TaxId: 9913]}
atlkditrrlksikniqkitksmkmvaaakyaraerelkparvylcgaihssvakqmkla
niiyyslkesttseqsarmtamdnasknasemidkltltfnrtrqavitkelieiisgaa
al

SCOPe Domain Coordinates for d1cowg_:

Click to download the PDB-style file with coordinates for d1cowg_.
(The format of our PDB-style files is described here.)

Timeline for d1cowg_: