Lineage for d5jhwa_ (5jhw A:)

  1. Root: SCOPe 2.06
  2. 2229111Class g: Small proteins [56992] (94 folds)
  3. 2232568Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
    disulfide-rich fold; common core is all-beta
  4. 2232569Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) (S)
  5. 2232868Family g.17.1.0: automated matches [191392] (1 protein)
    not a true family
  6. 2232869Protein automated matches [190506] (3 species)
    not a true protein
  7. 2232902Species Mouse (Mus musculus) [TaxId:10090] [188989] (6 PDB entries)
  8. 2288336Domain d5jhwa_: 5jhw A: [331637]
    automated match to d3hh2a_
    complexed with flc, po4

Details for d5jhwa_

PDB Entry: 5jhw (more details), 2.35 Å

PDB Description: crystal structure of the gdf11:follistatin 288 complex
PDB Compounds: (A:) Growth/differentiation factor 11

SCOPe Domain Sequences for d5jhwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jhwa_ g.17.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
nlgldcdehssesrccrypltvdfeafgwdwiiapkrykanycsgqceymfmqkyphthl
vqqanprgsagpcctptkmspinmlyfndkqqiiygkipgmvvdrcgcs

SCOPe Domain Coordinates for d5jhwa_:

Click to download the PDB-style file with coordinates for d5jhwa_.
(The format of our PDB-style files is described here.)

Timeline for d5jhwa_:

  • d5jhwa_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-23