Lineage for d5h4ua1 (5h4u A:1-207)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2061141Fold b.52: Double psi beta-barrel [50684] (2 superfamilies)
    barrel, closed; n=6, S=10; complex topology with crossover (psi) loops
  4. 2061142Superfamily b.52.1: Barwin-like endoglucanases [50685] (5 families) (S)
  5. 2061188Family b.52.1.0: automated matches [227180] (1 protein)
    not a true family
  6. 2061189Protein automated matches [226899] (3 species)
    not a true protein
  7. 2288333Species Cryptopygus antarcticus [TaxId:187623] [331634] (1 PDB entry)
  8. 2288334Domain d5h4ua1: 5h4u A:1-207 [331635]
    Other proteins in same PDB: d5h4ua2, d5h4ub2, d5h4uc2
    automated match to d1hd5a_

Details for d5h4ua1

PDB Entry: 5h4u (more details), 2.6 Å

PDB Description: crystal structure of cellulase from antarctic springtail, cryptopygus antarcticus
PDB Compounds: (A:) endo-beta-1,4-glucanase

SCOPe Domain Sequences for d5h4ua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5h4ua1 b.52.1.0 (A:1-207) automated matches {Cryptopygus antarcticus [TaxId: 187623]}
ltsgsgvttrywdcckpscswggkasvtkpvrtckangnttidsntqsgcnggssyvcnd
qqpftqgnvgygfaaasisgqpesqtccacyemtftntaisgqkmivqvtntgsdlngnh
fdlmipgggvgifngcqsqwgapsngwgqryggissqsecnqlptslragcnwrfgwfkn
adnpsmkftqvrcptiltqksqcvrtp

SCOPe Domain Coordinates for d5h4ua1:

Click to download the PDB-style file with coordinates for d5h4ua1.
(The format of our PDB-style files is described here.)

Timeline for d5h4ua1:

  • d5h4ua1 appears in periodic updates to SCOPe 2.06 starting on 2017-03-23