Lineage for d5jfba1 (5jfb A:477-577)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2209824Fold d.170: SRCR-like [56486] (2 superfamilies)
    unusual fold; disulfide-rich; core: beta-x-alpha-beta-loop-beta
  4. 2209825Superfamily d.170.1: SRCR-like [56487] (3 families) (S)
  5. 2288327Family d.170.1.0: automated matches [331628] (1 protein)
    not a true family
  6. 2288328Protein automated matches [331629] (1 species)
    not a true protein
  7. 2288329Species Sus scrofa [TaxId:9823] [331630] (2 PDB entries)
  8. 2288330Domain d5jfba1: 5jfb A:477-577 [331631]
    Other proteins in same PDB: d5jfba2, d5jfba3
    automated match to d1by2a_

Details for d5jfba1

PDB Entry: 5jfb (more details), 2 Å

PDB Description: crystal structure of the scavenger receptor cysteine-rich domain 5 (srcr5) from porcine cd163
PDB Compounds: (A:) Scavenger receptor cysteine-rich type 1 protein M130

SCOPe Domain Sequences for d5jfba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jfba1 d.170.1.0 (A:477-577) automated matches {Sus scrofa [TaxId: 9823]}
prlvggdipcsgrvevqhgdtwgtvcdsdfsleaasvlcrelqcgtvvsllggahfgegs
gqiwaeefqcegheshlslcpvaprpdgtcshsrdvgvvcs

SCOPe Domain Coordinates for d5jfba1:

Click to download the PDB-style file with coordinates for d5jfba1.
(The format of our PDB-style files is described here.)

Timeline for d5jfba1:

  • d5jfba1 appears in periodic updates to SCOPe 2.06 starting on 2017-03-23