SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5jfba1 (5jfb A:477-577)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2209824Fold d.170: SRCR-like [56486] (2 superfamilies)
    unusual fold; disulfide-rich; core: beta-x-alpha-beta-loop-beta
  4. 2209825Superfamily d.170.1: SRCR-like [56487] (3 families) (S)
  5. 2288327Family d.170.1.0: automated matches [331628] (1 protein)
    not a true family
  6. 2288328Protein automated matches [331629] (1 species)
    not a true protein
  7. 2288329Species Sus scrofa [TaxId:9823] [331630] (1 PDB entry)
  8. 2288330Domain d5jfba1: 5jfb A:477-577 [331631]
    Other proteins in same PDB: d5jfba2, d5jfba3
    automated match to d1by2a_

Details for d5jfba1

PDB Entry: 5jfb (more details), 2 Å

PDB Description: crystal structure of the scavenger receptor cysteine-rich domain 5 (srcr5) from porcine cd163
PDB Compounds: (A:) Scavenger receptor cysteine-rich type 1 protein M130

SCOPe Domain Sequences for d5jfba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jfba1 d.170.1.0 (A:477-577) automated matches {Sus scrofa [TaxId: 9823]}
prlvggdipcsgrvevqhgdtwgtvcdsdfsleaasvlcrelqcgtvvsllggahfgegs
gqiwaeefqcegheshlslcpvaprpdgtcshsrdvgvvcs

SCOPe Domain Coordinates for d5jfba1:

Click to download the PDB-style file with coordinates for d5jfba1.
(The format of our PDB-style files is described here.)

Timeline for d5jfba1:

  • d5jfba1 appears in periodic updates to SCOPe 2.06 starting on 2017-03-23