SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5iq0a_ (5iq0 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2134062Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2134063Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2136079Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2136080Protein automated matches [190543] (80 species)
    not a true protein
  7. 2136705Species Uncultured bacterium [TaxId:77133] [196706] (19 PDB entries)
  8. 2288319Domain d5iq0a_: 5iq0 A: [331620]
    automated match to d4j7aa_
    mutant

Details for d5iq0a_

PDB Entry: 5iq0 (more details), 1.8 Å

PDB Description: crystal structure of esterase mutant - f72g
PDB Compounds: (A:) esterase

SCOPe Domain Sequences for d5iq0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5iq0a_ c.69.1.0 (A:) automated matches {Uncultured bacterium [TaxId: 77133]}
msnatlnqlpgrlgdpsmslgtdprtdprlaaaltqlgladqaaeppvnansevadciay
staaeqawqtlgamlgsqgepsnpvdvreetikgrggneiklyihsptghtsdsdplpcv
vhthgggmviltaadanysrwrselaatglvvvgvefrnaagalgnhpfpaglhdcadaa
kwvasnrealgistlimsgesgggnlslattmlakkegwleeiagvyaqcpyisglyask
peelpsllendayfldmktmgamvkpydptgenasnplawpyhasledlaglpphvisvn
eldplrdeglahyrkllkagvstvgrtvhgtchaadcsfvdvipdvyfatvrdisafays
ra

SCOPe Domain Coordinates for d5iq0a_:

Click to download the PDB-style file with coordinates for d5iq0a_.
(The format of our PDB-style files is described here.)

Timeline for d5iq0a_:

  • d5iq0a_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-23