SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5gonc2 (5gon C:246-440)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2180205Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2180489Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) (S)
  5. 2180490Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 protein domains)
  6. 2180597Protein automated matches [227071] (5 species)
    not a true protein
  7. 2180601Species Cow (Bos taurus) [TaxId:9913] [226565] (36 PDB entries)
  8. 2288318Domain d5gonc2: 5gon C:246-440 [331619]
    Other proteins in same PDB: d5gona1, d5gonb1, d5gonc1, d5gond1, d5gone_, d5gonf1, d5gonf2
    automated match to d1tuba2
    complexed with 6zr, ca, gdp, gol, gtp, imd, mes, mg

Details for d5gonc2

PDB Entry: 5gon (more details), 2.48 Å

PDB Description: structures of a beta-lactam bridged analogue in complex with tubulin
PDB Compounds: (C:) Tubulin alpha-1B chain

SCOPe Domain Sequences for d5gonc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5gonc2 d.79.2.1 (C:246-440) automated matches {Cow (Bos taurus) [TaxId: 9913]}
galnvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepanqmvkc
dprhgkymaccllyrgdvvpkdvnaaiatiktkrsiqfvdwcptgfkvginyqpptvvpg
gdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedm
aalekdyeevgvdsv

SCOPe Domain Coordinates for d5gonc2:

Click to download the PDB-style file with coordinates for d5gonc2.
(The format of our PDB-style files is described here.)

Timeline for d5gonc2:

  • d5gonc2 appears in periodic updates to SCOPe 2.06 starting on 2017-03-23