Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) automatically mapped to Pfam PF00091 |
Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins) |
Protein automated matches [226837] (9 species) not a true protein |
Species Cow (Bos taurus) [TaxId:9913] [226564] (136 PDB entries) |
Domain d5gonc1: 5gon C:1-245 [331618] Other proteins in same PDB: d5gona2, d5gonb2, d5gonc2, d5gond2, d5gone_, d5gonf1, d5gonf2 automated match to d1tuba1 complexed with 6zr, ca, gdp, gol, gtp, imd, mes, mg |
PDB Entry: 5gon (more details), 2.48 Å
SCOPe Domain Sequences for d5gonc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5gonc1 c.32.1.1 (C:1-245) automated matches {Cow (Bos taurus) [TaxId: 9913]} mrecisihvgqagvqignacwelyclehgiqpdgqmpsdktigggddsfntffsetgagk hvpravfvdleptvidevrtgtyrqlfhpeqlitgkedaannyarghytigkeiidlvld rirkladqctglqgflvfhsfgggtgsgftsllmerlsvdygkksklefsiypapqvsta vvepynsiltthttlehsdcafmvdneaiydicrrnldierptytnlnrlisqivssita slrfd
Timeline for d5gonc1: