![]() | Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
![]() | Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
![]() | Superfamily f.23.3: Mitochondrial cytochrome c oxidase subunit VIc [81415] (1 family) ![]() automatically mapped to Pfam PF02937 |
![]() | Family f.23.3.1: Mitochondrial cytochrome c oxidase subunit VIc [81414] (1 protein) |
![]() | Protein Mitochondrial cytochrome c oxidase subunit VIc [81413] (1 species) function unknown, probably acts as a regulator or is required for the assembly |
![]() | Species Cow (Bos taurus) [TaxId:9913] [81412] (57 PDB entries) |
![]() | Domain d5b3si1: 5b3s I:2-73 [331604] Other proteins in same PDB: d5b3sa1, d5b3sa2, d5b3sb1, d5b3sb2, d5b3sb3, d5b3sc_, d5b3sd_, d5b3se_, d5b3sf_, d5b3sg_, d5b3sh_, d5b3si2, d5b3sj_, d5b3sk_, d5b3sl_, d5b3sm_, d5b3sn1, d5b3sn2, d5b3so1, d5b3so2, d5b3so3, d5b3sp_, d5b3sq_, d5b3sr_, d5b3ss_, d5b3st_, d5b3su_, d5b3sv2, d5b3sw_, d5b3sx_, d5b3sy_, d5b3sz_ automated match to d1v54i_ complexed with cdl, chd, cmo, cu, cua, dmu, edo, hea, mg, na, pek, pgv, psc, tgl, zn |
PDB Entry: 5b3s (more details), 1.68 Å
SCOPe Domain Sequences for d5b3si1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5b3si1 f.23.3.1 (I:2-73) Mitochondrial cytochrome c oxidase subunit VIc {Cow (Bos taurus) [TaxId: 9913]} talakpqmrgllarrlrfhivgafmvslgfatfykfavaekrkkayadfyrnydsmkdfe emrkagifqsak
Timeline for d5b3si1:
![]() Domains from other chains: (mouse over for more information) d5b3sa1, d5b3sa2, d5b3sb1, d5b3sb2, d5b3sb3, d5b3sc_, d5b3sd_, d5b3se_, d5b3sf_, d5b3sg_, d5b3sh_, d5b3sj_, d5b3sk_, d5b3sl_, d5b3sm_, d5b3sn1, d5b3sn2, d5b3so1, d5b3so2, d5b3so3, d5b3sp_, d5b3sq_, d5b3sr_, d5b3ss_, d5b3st_, d5b3su_, d5b3sv1, d5b3sv2, d5b3sw_, d5b3sx_, d5b3sy_, d5b3sz_ |