SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5b3sg_ (5b3s G:)

  1. Root: SCOPe 2.06
  2. 2223823Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2226297Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2226358Superfamily f.23.2: Mitochondrial cytochrome c oxidase subunit VIa [81411] (1 family) (S)
    automatically mapped to Pfam PF02046
  5. 2226359Family f.23.2.1: Mitochondrial cytochrome c oxidase subunit VIa [81410] (2 protein domains)
  6. 2226360Protein Mitochondrial cytochrome c oxidase subunit VIa [81409] (1 species)
    probably responsible for the dimerization of the mitochondrial cytochrome c oxidase
  7. 2226361Species Cow (Bos taurus) [TaxId:9913] [81408] (30 PDB entries)
  8. 2288301Domain d5b3sg_: 5b3s G: [331602]
    Other proteins in same PDB: d5b3sa1, d5b3sa2, d5b3sb1, d5b3sb2, d5b3sb3, d5b3sc_, d5b3sd_, d5b3se_, d5b3sf_, d5b3sh_, d5b3si1, d5b3si2, d5b3sj_, d5b3sk_, d5b3sl_, d5b3sm_, d5b3sn1, d5b3sn2, d5b3so1, d5b3so2, d5b3so3, d5b3sp_, d5b3sq_, d5b3sr_, d5b3ss_, d5b3su_, d5b3sv1, d5b3sv2, d5b3sw_, d5b3sx_, d5b3sy_, d5b3sz_
    automated match to d1v54g_
    complexed with cdl, chd, cmo, cu, cua, dmu, edo, hea, mg, na, pek, pgv, psc, tgl, zn

Details for d5b3sg_

PDB Entry: 5b3s (more details), 1.68 Å

PDB Description: bovine heart cytochrome c oxidase in the carbon monoxide-bound mixed- valence state at 1.68 angstrom resolution (50 k)
PDB Compounds: (G:) Cytochrome c oxidase subunit 6A2, mitochondrial

SCOPe Domain Sequences for d5b3sg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5b3sg_ f.23.2.1 (G:) Mitochondrial cytochrome c oxidase subunit VIa {Cow (Bos taurus) [TaxId: 9913]}
asaakgdhggtgartwrfltfglalpsvalctlnswlhsghrerpafipyhhlrirtkpf
swgdgnhtffhnprvnplptgyek

SCOPe Domain Coordinates for d5b3sg_:

Click to download the PDB-style file with coordinates for d5b3sg_.
(The format of our PDB-style files is described here.)

Timeline for d5b3sg_:

  • d5b3sg_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-23