Lineage for d1bmfg_ (1bmf G:)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 316067Fold c.49: Pyruvate kinase C-terminal domain-like [52934] (2 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145, strand 5 is antiparallel to the rest
  4. 316159Superfamily c.49.2: ATP synthase (F1-ATPase), gamma subunit [52943] (1 family) (S)
    contains an antiparallel coiled coil formed by N- and C-terminal extensions to the common fold
  5. 316160Family c.49.2.1: ATP synthase (F1-ATPase), gamma subunit [52944] (1 protein)
  6. 316161Protein ATP synthase (F1-ATPase), gamma subunit [52945] (3 species)
  7. 316162Species Cow (Bos taurus) [TaxId:9913] [52946] (10 PDB entries)
  8. 316166Domain d1bmfg_: 1bmf G: [33160]
    Other proteins in same PDB: d1bmfa1, d1bmfa2, d1bmfa3, d1bmfb1, d1bmfb2, d1bmfb3, d1bmfc1, d1bmfc2, d1bmfc3, d1bmfd1, d1bmfd2, d1bmfd3, d1bmfe1, d1bmfe2, d1bmfe3, d1bmff1, d1bmff2, d1bmff3
    core domain is disordered; only coiled coil part is visible
    complexed with adp, anp, mg

Details for d1bmfg_

PDB Entry: 1bmf (more details), 2.85 Å

PDB Description: bovine mitochondrial f1-atpase

SCOP Domain Sequences for d1bmfg_:

Sequence, based on SEQRES records: (download)

>d1bmfg_ c.49.2.1 (G:) ATP synthase (F1-ATPase), gamma subunit {Cow (Bos taurus)}
atlkditrrlksikniqkitksmkmvaaakyaraerelkparvygvgslalyekadiktp
edkkkhliigvssdrglcgaihssvakqmkseaanlaaagkevkiigvgdkirsilhrth
sdqflvtfkevgrrpptfgdasvialellnsgyefdegsiifnrfrsvisykteekpifs
ldtissaesmsiyddidadvlrnyqeyslaniiyyslkesttseqsarmtamdnasknas
emidkltltfnrtrqavitkelieiisgaaal

Sequence, based on observed residues (ATOM records): (download)

>d1bmfg_ c.49.2.1 (G:) ATP synthase (F1-ATPase), gamma subunit {Cow (Bos taurus)}
atlkditrrlksikniqkitksmkmvaaakyaraerelkparvylcgaihssvakqmkla
niiyyslkesttseqsarmtamdnasknasemidkltltfnrtrqavitkelieiisgaa
al

SCOP Domain Coordinates for d1bmfg_:

Click to download the PDB-style file with coordinates for d1bmfg_.
(The format of our PDB-style files is described here.)

Timeline for d1bmfg_: