Class a: All alpha proteins [46456] (290 folds) |
Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
Superfamily a.3.1: Cytochrome c [46626] (9 families) covalently-bound heme completes the core |
Family a.3.1.0: automated matches [191374] (1 protein) not a true family |
Protein automated matches [190453] (26 species) not a true protein |
Species Thermosynechococcus vulcanus [TaxId:32053] [329405] (6 PDB entries) |
Domain d5ws5v_: 5ws5 v: [331593] Other proteins in same PDB: d5ws5a_, d5ws5b_, d5ws5c_, d5ws5d_, d5ws5e_, d5ws5f_, d5ws5h_, d5ws5i_, d5ws5j_, d5ws5k_, d5ws5l_, d5ws5m1, d5ws5m2, d5ws5o_, d5ws5t_, d5ws5u_, d5ws5x_, d5ws5z_ automated match to d1e29a_ complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hec, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl |
PDB Entry: 5ws5 (more details), 2.35 Å
SCOPe Domain Sequences for d5ws5v_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ws5v_ a.3.1.0 (v:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]} aeltpevltvplnsegktitltekqylegkrlfqyacaschvggitktnpsldlrtetla latpprdnieglvdymknpttydgeqeiaevhpslrsadifpkmrnltekdlvaiaghil vepkilgdkwgggkvyy
Timeline for d5ws5v_: