Lineage for d5ws5k_ (5ws5 k:)

  1. Root: SCOPe 2.06
  2. 2223823Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2226297Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2227418Superfamily f.23.36: Photosystem II reaction center protein K, PsbK [161037] (2 families) (S)
    automatically mapped to Pfam PF02533
  5. 2227419Family f.23.36.1: PsbK-like [161038] (1 protein)
    Pfam PF02533
  6. 2227420Protein Photosystem II reaction center protein K, PsbK [161039] (2 species)
  7. 2227425Species Thermosynechococcus vulcanus [TaxId:32053] [192450] (10 PDB entries)
  8. 2288278Domain d5ws5k_: 5ws5 k: [331579]
    Other proteins in same PDB: d5ws5a_, d5ws5b_, d5ws5c_, d5ws5e_, d5ws5f_, d5ws5h_, d5ws5j_, d5ws5o_, d5ws5v_, d5ws5x_, d5ws5z_
    automated match to d2axtk1
    complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl

Details for d5ws5k_

PDB Entry: 5ws5 (more details), 2.35 Å

PDB Description: native xfel structure of photosystem ii (preflash dark dataset)
PDB Compounds: (k:) Photosystem II protein K

SCOPe Domain Sequences for d5ws5k_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ws5k_ f.23.36.1 (k:) Photosystem II reaction center protein K, PsbK {Thermosynechococcus vulcanus [TaxId: 32053]}
klpeayaifdplvdvlpvipvlflalafvwqaavgfr

SCOPe Domain Coordinates for d5ws5k_:

Click to download the PDB-style file with coordinates for d5ws5k_.
(The format of our PDB-style files is described here.)

Timeline for d5ws5k_:

  • d5ws5k_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-17