Lineage for d5ws5j_ (5ws5 j:)

  1. Root: SCOPe 2.06
  2. 2250849Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2253581Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2254789Superfamily f.23.32: Photosystem II reaction center protein J, PsbJ [161021] (1 family) (S)
    automatically mapped to Pfam PF01788
  5. 2254790Family f.23.32.1: PsbJ-like [161022] (2 proteins)
    Pfam PF01788
  6. 2254800Protein automated matches [191002] (3 species)
    not a true protein
  7. 2254808Species Thermosynechococcus vulcanus [TaxId:32053] [189916] (9 PDB entries)
  8. 2254816Domain d5ws5j_: 5ws5 j: [331577]
    Other proteins in same PDB: d5ws5a_, d5ws5b_, d5ws5c_, d5ws5e_, d5ws5f_, d5ws5h_, d5ws5k_, d5ws5o_, d5ws5v_, d5ws5x_, d5ws5z_
    automated match to d5b5ej_
    complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl

Details for d5ws5j_

PDB Entry: 5ws5 (more details), 2.35 Å

PDB Description: native xfel structure of photosystem ii (preflash dark dataset)
PDB Compounds: (j:) Photosystem II reaction center protein J

SCOPe Domain Sequences for d5ws5j_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ws5j_ f.23.32.1 (j:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]}
mseggriplwivatvagmgvivivglffygayaglgssl

SCOPe Domain Coordinates for d5ws5j_:

Click to download the PDB-style file with coordinates for d5ws5j_.
(The format of our PDB-style files is described here.)

Timeline for d5ws5j_: