Lineage for d5h68b_ (5h68 B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2113903Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2113904Protein automated matches [190123] (130 species)
    not a true protein
  7. 2287675Species Geobacillus stearothermophilus [TaxId:272567] [330976] (1 PDB entry)
  8. 2288270Domain d5h68b_: 5h68 B: [331571]
    automated match to d1e69a_
    complexed with ags, mg

Details for d5h68b_

PDB Entry: 5h68 (more details), 1.98 Å

PDB Description: crystal structure of an engaged dimer of the geobacillus stearothermophilus smc head domain
PDB Compounds: (B:) Chromosome partition protein Smc

SCOPe Domain Sequences for d5h68b_:

Sequence, based on SEQRES records: (download)

>d5h68b_ c.37.1.0 (B:) automated matches {Geobacillus stearothermophilus [TaxId: 272567]}
mflkrldvigfksfadrvsiefvpgvtavvgpngsgksnitdairwvlgeqsakslrgak
medvifagsesrkplnvaevtitldnedgflpleyqevsvtrrvyrsgeseffinrqpcr
lkdivdlfldsglgkeafsiigqgrveeilsskpeerrtifeeaagvlkgsgggsgeemk
krflttfeqirahfgevfgelfgggradlrltdpndlletgidivaqppgkklqhlslls
ggeraltaiallfsilkvrpvpfcvldqveaaldeanvqryaqylkrfsrdtqfivithr
kgtmeeadvlygvtmqesgvsklvsvrledskelvr

Sequence, based on observed residues (ATOM records): (download)

>d5h68b_ c.37.1.0 (B:) automated matches {Geobacillus stearothermophilus [TaxId: 272567]}
mflkrldvigfksfadrvsiefvpgvtavvgpngsgksnitdairwvlgeqsakslrgak
medvifagsesrkplnvaevtitldnedgflpleyqevsvtrrvyrsgeseffinrqpcr
lkdivdlfldsglgkeafsiigqgrveeilsskpeerrtifeeaagvgggsgeemkkrfl
ttfeqirahfgevfgelfgggradlrltdpndlletgidivaqppgkklqhlsllsgger
altaiallfsilkvrpvpfcvldqveaaldeanvqryaqylkrfsrdtqfivithrkgtm
eeadvlygvtmqesgvsklvsvrledskelvr

SCOPe Domain Coordinates for d5h68b_:

Click to download the PDB-style file with coordinates for d5h68b_.
(The format of our PDB-style files is described here.)

Timeline for d5h68b_:

  • d5h68b_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-17