Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (239 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [186944] (46 PDB entries) |
Domain d5uauc1: 5uau C:1-164 [331565] Other proteins in same PDB: d5uaua2, d5uaub2, d5uaub3, d5uauc2, d5uauc3, d5uaud2, d5uaue2 automated match to d2izza1 complexed with pro, so4 |
PDB Entry: 5uau (more details), 1.9 Å
SCOPe Domain Sequences for d5uauc1:
Sequence, based on SEQRES records: (download)
>d5uauc1 c.2.1.0 (C:1-164) automated matches {Human (Homo sapiens) [TaxId: 9606]} msvgfigagqlafalakgftaagvlaahkimasspdmdlatvsalrkmgvkltphnketv qhsdvlflavkphiipfildeigadiedrhivvscaagvtissiekklsafrpaprvirc mtntpvvvregatvyatgthaqvedgrlmeqllssvgfctevee
>d5uauc1 c.2.1.0 (C:1-164) automated matches {Human (Homo sapiens) [TaxId: 9606]} msvgfigagqlafalakgftaagvlaahkimasspdmtvsalrkmgvkltphnketvqhs dvlflavkphiipfildeigadiedrhivvscaagvtissiekklsafrpaprvircmtn tpvvvregatvyatgthaqvedgrlmeqllssvgfctevee
Timeline for d5uauc1: