Lineage for d1e0uc3 (1e0u C:354-470)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 993924Fold c.49: Pyruvate kinase C-terminal domain-like [52934] (2 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145, strand 5 is antiparallel to the rest
  4. 993925Superfamily c.49.1: PK C-terminal domain-like [52935] (2 families) (S)
  5. 993926Family c.49.1.1: Pyruvate kinase, C-terminal domain [52936] (1 protein)
  6. 993927Protein Pyruvate kinase, C-terminal domain [52937] (6 species)
  7. 993935Species Escherichia coli [TaxId:562] [52942] (3 PDB entries)
  8. 993946Domain d1e0uc3: 1e0u C:354-470 [33156]
    Other proteins in same PDB: d1e0ua1, d1e0ua2, d1e0ub1, d1e0ub2, d1e0uc1, d1e0uc2, d1e0ud1, d1e0ud2
    complexed with so4; mutant

Details for d1e0uc3

PDB Entry: 1e0u (more details), 2.8 Å

PDB Description: structure r271l mutant of e. coli pyruvate kinase
PDB Compounds: (C:) pyruvate kinase

SCOPe Domain Sequences for d1e0uc3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e0uc3 c.49.1.1 (C:354-470) Pyruvate kinase, C-terminal domain {Escherichia coli [TaxId: 562]}
iteavcrgavetaekldaplivvatqggksaravrkyfpdatilalttnektahqlvlsk
gvvpqlvkeitstddfyrlgkelalqsglahkgdvvvmvsgalvpsgttntasvhvl

SCOPe Domain Coordinates for d1e0uc3:

Click to download the PDB-style file with coordinates for d1e0uc3.
(The format of our PDB-style files is described here.)

Timeline for d1e0uc3: