Lineage for d5uaub2 (5uau B:165-274)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006475Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
    multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry
  4. 2006476Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) (S)
    N-terminal domain is Rossmann-fold with a family-specific C-terminal extension
  5. 2006685Family a.100.1.0: automated matches [227147] (1 protein)
    not a true family
  6. 2006686Protein automated matches [226851] (35 species)
    not a true protein
  7. 2006765Species Human (Homo sapiens) [TaxId:9606] [225061] (18 PDB entries)
  8. 2006795Domain d5uaub2: 5uau B:165-274 [331554]
    Other proteins in same PDB: d5uaua1, d5uaub1, d5uaub3, d5uauc1, d5uauc3, d5uaud1, d5uaue1
    automated match to d2izzc2
    complexed with pro, so4

Details for d5uaub2

PDB Entry: 5uau (more details), 1.9 Å

PDB Description: structure of human pycr-1 complexed with proline
PDB Compounds: (B:) Pyrroline-5-carboxylate reductase 1, mitochondrial

SCOPe Domain Sequences for d5uaub2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5uaub2 a.100.1.0 (B:165-274) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlidavtglsgsgpayaftaldaladggvkmglprrlavrlgaqallgaakmllhseqhp
gqlkdnvsspggatihalhvlesggfrsllinaveascirtrelqsmadq

SCOPe Domain Coordinates for d5uaub2:

Click to download the PDB-style file with coordinates for d5uaub2.
(The format of our PDB-style files is described here.)

Timeline for d5uaub2: