SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5tw3a2 (5tw3 A:430-552)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2122050Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2123751Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) (S)
    consists of one domain of this fold
  5. 2124881Family c.55.3.0: automated matches [191357] (1 protein)
    not a true family
  6. 2124882Protein automated matches [190396] (34 species)
    not a true protein
  7. 2125009Species Human immunodeficiency virus type 1 group m subtype b (isolate bh10) [TaxId:11678] [275362] (8 PDB entries)
  8. 2288229Domain d5tw3a2: 5tw3 A:430-552 [331530]
    Other proteins in same PDB: d5tw3a1, d5tw3b_
    automated match to d1dloa1
    protein/DNA complex; complexed with 7n1, mg

Details for d5tw3a2

PDB Entry: 5tw3 (more details), 2.85 Å

PDB Description: crystal structure of hiv-1 reverse transcriptase in complex with 5-(2- (2-(2,4-dioxo-3,4-dihydropyrimidin-1(2h)-yl)ethoxy)-4-fluorophenoxy)- 7-fluoro-2-naphthonitrile (jlj636), a non-nucleoside inhibitor
PDB Compounds: (A:) HIV-1 reverse transcriptase, p66 subunit

SCOPe Domain Sequences for d5tw3a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tw3a2 c.55.3.0 (A:430-552) automated matches {Human immunodeficiency virus type 1 group m subtype b (isolate bh10) [TaxId: 11678]}
ekepivgaetfyvdgaanretklgkagyvtnkgrqkvvpltnttnqktelqaiylalqds
glevnivtdsqyalgiiqaqpdkseselvnqiieqlikkekvylawvpahkgiggneqvd
klv

SCOPe Domain Coordinates for d5tw3a2:

Click to download the PDB-style file with coordinates for d5tw3a2.
(The format of our PDB-style files is described here.)

Timeline for d5tw3a2:

  • d5tw3a2 appears in periodic updates to SCOPe 2.06 starting on 2017-03-16

View in 3D
Domains from same chain:
(mouse over for more information)
d5tw3a1
View in 3D
Domains from other chains:
(mouse over for more information)
d5tw3b_